PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00094960001
Common NameGSBRNA2T00094960001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 231aa    MW: 24847.9 Da    PI: 8.4664
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00094960001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.81.5e-352784461
               zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                         + l+cprC+s  tkfCyynny+l qPryfCk+CrryWt+GG+lr+vPvGgg+r++ ++
  GSBRNA2T00094960001 27 EPLPCPRCNSIITKFCYYNNYNLLQPRYFCKSCRRYWTQGGTLRDVPVGGGTRRSSSK 84
                         6789*************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-232778IPR003851Zinc finger, Dof-type
PfamPF027011.1E-312883IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.8852983IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MPSESNQTRP ARVQGSTAAY PPPNMAEPLP CPRCNSIITK FCYYNNYNLL QPRYFCKSCR  60
RYWTQGGTLR DVPVGGGTRR SSSKRNRSFS SNATTASSSS SSSCSASVIT MSQGTVTNEA  120
KGSNLNSGHG SFASLLSEQS DGAAFLALGS GTGGLDYEFG YGYGLEDMSI GSIPVVGGGD  180
TWQIKEIGGK SGDSLIWPGF NSKQQCLLIP LLFCLFLFRF FCLFSYPREE *
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00094960001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0889462e-77AY088946.1 Arabidopsis thaliana clone 103581 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590549.11e-100PREDICTED: dof zinc finger protein DOF1.6
SwissprotQ9SX971e-69DOF16_ARATH; Dof zinc finger protein DOF1.6
TrEMBLA0A078FVB91e-169A0A078FVB9_BRANA; BnaA08g03730D protein
STRINGBra015609.1-P9e-89(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94652435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G47655.11e-67Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]